Myneta.info is an open data repository platform of Association for Democratic Reforms (ADR).
Myneta Logo Myneta Logo
Home Lok Sabha State Assemblies Rajya Sabha Political Parties Electoral Bonds || माय नेता हिंदी में || About MyNeta About ADR
State Assemblies Rajya Sabha Political Parties
1 2 3 4
HomeTamilNadu 2026NAGAPATTINAMVEDHARANYAMTHIVASKAR. B(Criminal & Asset Declaration)

TamilNadu 2026

profile image

THIVASKAR. B

VEDHARANYAM (NAGAPATTINAM)
Party:IND
S/o|D/o|W/o: Baskaran
Age: 35
Name Enrolled as Voter in: 165 Vedaranyam constituency, at Serial no 733 in Part no 50

Self Profession:Advocate
Spouse Profession:NIL

Crime-O-Meter


Number of Criminal Cases: 1

Assets & Liabilities


Assets: Rs 62,52,733 ~62 Lacs+
Liabilities: Rs 16,32,900 ~16 Lacs+

Educational Details


Category: Graduate Professional
B.A., B.L., Bachelor Of Law., Govt Law College Tirunelveli 2012

Details of PAN and status of Income Tax return

Relation TypePAN GivenFinancial YearTotal Income Shown in ITR
selfYNoneNone ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
spouse ** Nil
** Nil
** Nil
** Nil
** Nil
huf ** Nil
** Nil
** Nil
** Nil
** Nil
dependent1YNoneNone ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
dependent2YNoneNone ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
dependent3YNoneNone ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
None ** Rs 0 ~
Data Readability Report of PAN and Income Tax :No Problems in Reading Affidavit Information

Details of Criminal Cases

Brief Details of IPC / BNS

Cases where Pending

Serial No.FIR No.Case No.Court LAW / Section Type IPC/BNS Sections ApplicableOther Details / Other Acts / Sections Applicable Charges Framed Date on which charges were framedAppeal FiledDetails and present status of appeal
1 312/2024, Nagore Police Station BNS 191(2), 296(B), 132, 351(2), Yes 06 Sep 2024No

Cases where Convicted

Serial No.Case No.Court LAW / Section Type IPC/BNS Sections ApplicableOther Details / Other Acts / Sections Applicable Punishment ImposedDate on which convictedAppeal FiledDetails and present status of appeal
---------No Cases--------

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Criminal Cases :No Problems in Reading Affidavit Information

Details of Movable Assets

Sr NoDescriptionselfspousehufdependent1dependent2dependent3
iCash 5,000  5 Thou+

NilNil 5,000  5 Thou+

5,000  5 Thou+

Nil Rs 15,000
15 Thou+
iiDeposits in Banks, Financial Institutions and Non-Banking Financial CompaniesVedaranyam State Bank Of India
136  1 Hund+

Indian Bank
5,402  5 Thou+

Flood Pallam Tamil Nadu
485  4 Hund+

Thalaigniyirt Kumbakonam Center Co Operative Bank
1,282  1 Thou+

Grove Indian Overseas Bank
1,000  1 Thou+

NilNilKallimeedu Indian Bank
3,800  3 Thou+

Vallapallam TamilNadu Village Bank
502  5 Hund+

Kallimedu Indian Bank
1,234  1 Thou+

Muthupettai SBI Bank
500  5 Hund+

Vedaranyam Bharat State Bank
2,540  2 Thou+

Perambalur Punjab National Bank
10,593  10 Thou+

Vellapallam Tamil Nadu Grama Bank
59  

Rs 27,533
27 Thou+
iiiBonds, Debentures and Shares in companiesNilNilNilNilNilNil Nil
iv(a)
NSS, Postal Savings etc
NilNilNilNilNilNil Nil
(b)
LIC or other insurance Policies
LIC Policy
2,00,000  2 Lacs+

NilNilNilLIC Policy
1,00,000  1 Lacs+

Nil Rs 3,00,000
3 Lacs+
vPersonal loans/advance given NilNilNilNilNilNil Nil
viMotor Vehicles (details of make, etc.)Bajaj CT 100 Reg No.TN51 AH4 120 2017
50,000  50 Thou+

NilNilNilHonda Scooty , TN51AS 2306, 2023
1,10,000  1 Lacs+

TATA Ace ,TN05AY 0383 2026
2,85,000  2 Lacs+

Nil Rs 4,45,000
4 Lacs+
viiJewellery (give details weight value)32gm Gold
3,20,000  3 Lacs+

NilNil31gm Gold
3,10,000  3 Lacs+

NilNil Rs 6,30,000
6 Lacs+
viiiOther assets, such as values of claims / interestsNilNilNilNilNilNil Nil
Gross Total Value (as per Affidavit) 5,83,305  5 Lacs+ Nil Nil 3,19,302  3 Lacs+ 5,01,734  5 Lacs+ 13,192  13 Thou+ Rs 14,17,533
14 Lacs+
Totals (Calculated as Sum of Values) Rs 5,83,305
5 Lacs+
Nil
Nil
Rs 3,19,302
3 Lacs+
Rs 5,01,734
5 Lacs+
Rs 13,192
13 Thou+
Rs 14,17,533
14 Lacs+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Movable Assets :No Problems in Reading Affidavit Information

Details of Immovable Assets

Sr NoDescriptionselfspousehufdependent1dependent2dependent3
iAgricultural LandVallapalam Sur No 33/2, 33/4, 33/5, 33/6,33/7,33/8,33/9, 33/10A, 33/11, 33/12, 33/13, 33/24 AREA: 0.200 Ares, 0.2.25 Ares, 0.875 Ares, 0.2.75 Ares, 0.875Ares, 0.1.75Ares, 0.625Ares, 0.0.05Ares, 0.375Ares, 0.625Ares, 0.0.05Ares, 0.375 Ares, 0.625Ares, 0.11.25Ares, 0.4.05Ares, 0.2.75 Ares, 0.2.00 Ares
Total Area 0.34.8 Ares
Built Up Area
Whether Inherited Y
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
2,08,800  2 Lacs+

NilNilVallapalam Sur No 33/2, 33/4, 33/5, 33/6,33/7,33/8,33/9, 33/10A, 33/11, 33/12, 33/13, 33/24, 34/1, 34/2B, 34/3B, 34/12 Area: 0.2.00Ares, 0.2.25Ares, 0.875 Ares, 0.1.25Ares, 0.875Ares, 0.1.75 Ares, 0.625Ares, 0.0.05Ares, 0.375Ares, 0.625Ares, 0.11.25Ares, 0.4.05Ares, 0.2.75Ares, 0.2.75Ares, 0.2.00Ares
Total Area 0.34.8Ares
Built Up Area
Whether Inherited Y
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
2,08,800  2 Lacs+

Vallapalam Sur No 33/2, 33/4, 33/5, 33/6,33/7,33/8,33/9, 33/10A, 33/11, 33/12, 33/13, 33/24, 34/1, 34/2B, 34/3B, 34/12 Area: 0.2.00Ares, 0.2.25Ares, 0.875 Ares, 0.1.25Ares, 0.875Ares, 0.2.75Ares, 0.875Ares, 0.1.75Ares, 0.625Ares, 0.005Ares, 0.375Ares, 0.625Ares, 0.11.25Ares, 0.4.05Ares, 0.2.75Ares, 0.2.00Ares
Total Area 0.34.6Ares
Built Up Area
Whether Inherited Y
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
2,08,800  2 Lacs+

Vallapalam Sur No 33/2, 33/4, 33/5, 33/6,33/7,33/8,33/9, 33/10A, 33/11, 33/12, 33/13, 33/24, 34/1, 34/2B, 34/3B, 34/12 Area: 0.2.00Ares, 0.2.25Ares, 0.875 Ares, 0.1.25Ares, 0.875Ares, 0.2.75Ares, 0.875Ares, 0.1.75Ares, 0.625Ares, 0.005Ares, 0.375Ares, 0.625Ares, 0.11.25Ares, 0.4.05Ares, 0.2.75Ares,0.2.00Ares
Total Area 0.34.8Ares
Built Up Area
Whether Inherited Y
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 0.00
2,08,800  2 Lacs+

Rs 8,35,200
8 Lacs+
iiNon Agricultural LandMannarkudi Muthalsethi Sur No 111/3
Total Area 488 sq ft
Built Up Area
Whether Inherited N
Purchase Date 2023-02-16
Purchase Cost 122400.00
Development Cost 0.00
2,00,000  2 Lacs+

NilNilNilNilNil Rs 2,00,000
2 Lacs+
iiiCommercial BuildingsVellapalam 10/2B
Total Area 15660 sq ft
Built Up Area 600 sq ft
Whether Inherited N
Purchase Date 2022-03-25
Purchase Cost 36250.00
Development Cost 800000.00
10,00,000  10 Lacs+

NilNilNilNilNil Rs 10,00,000
10 Lacs+
ivResidential BuildingsNilNilNilVellapalam Sur No 34/16
Total Area 700sq ft
Built Up Area 700sq ft
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 150000.00
1,50,000  1 Lacs+

Vellapalam Sur No 34/16
Total Area 700sq ft
Built Up Area 700 sq ft
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 150000.00
1,50,000  1 Lacs+

Vellapalam Sur No 34/16
Total Area 900 sq ft
Built Up Area 900 sq ft
Whether Inherited N
Purchase Date 0000-00-00
Purchase Cost 0.00
Development Cost 2500000.00
25,00,000  25 Lacs+

Rs 28,00,000
28 Lacs+
vOthersNilNilNilNilNilNil Nil
Total Current Market Value of (i) to (v) (as per Affidavit) 14,08,800  14 Lacs+ Nil Nil 3,58,800  3 Lacs+ 3,58,800  3 Lacs+ 27,08,800  27 Lacs+ Rs 48,35,200
48 Lacs+
Totals Calculated Rs 14,08,800
14 Lacs+
Nil
Nil
Rs 3,58,800
3 Lacs+
Rs 3,58,800
3 Lacs+
Rs 27,08,800
27 Lacs+
Rs 48,35,200
48 Lacs+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Immovable Assets :No Problems in Reading Affidavit Information

Details of Liabilities

Sr NoDescriptionselfspousehufdependent1dependent2dependent3
iLoans from Banks / FIsThiruthurai poondi Veritas Finance Mirtgage Loan
5,70,000  5 Lacs+

Vellapallam Tamilnadu Village Bank Jewel Loan
2,59,000  2 Lacs+

Kovilpandu Cooperative Loan Society Agri Loan
60,900  60 Thou+

Kovilpandu Cooperative Loan Society Cow Loan
42,000  42 Thou+

NilNilThalainayiru Muthoot Finance Personal Loan
2,50,000  2 Lacs+

Vanavan Mahadevi Kurinji Mahalir Group Kallimeedu Indian Bank Group Loan
1,00,000  1 Lacs+

Vedaranyam Village Cooperative Group Loan
65,000  65 Thou+

Vedaranyam Bhoosan Group Loan
76,000  76 Thou+

Vedaranyam Equitas Vehicle loan
2,10,000  2 Lacs+

Nil Rs 16,32,900
16 Lacs+
Loans due to Individual / EntityNilNilNilNilNilNil Nil
Any other LiabilityNilNilNilNilNilNil Nil
Grand Total of Liabilities (as per affidavit) 9,31,900  9 Lacs+ Nil Nil 4,91,000  4 Lacs+ 2,10,000  2 Lacs+ Nil Rs 16,32,900
16 Lacs+
iiDues to departments dealing with government accommodationNilNilNilNilNilNil Nil
Dues to departments dealing with supply of waterNilNilNilNilNilNil Nil
Dues to departments dealing with supply of electricityNilNilNilNilNilNil Nil
Dues to departments dealing with telephonesNilNilNilNilNilNil Nil
Dues to departments dealing with supply of transportNilNilNilNilNilNil Nil
Income Tax DuesNilNilNilNilNilNil Nil
Wealth Tax DuesNilNilNilNilNilNil Nil
Service Tax DuesNilNilNilNilNilNil Nil
Property Tax DuesNilNilNilNilNilNil Nil
Sales Tax DuesNilNilNilNilNilNil Nil
GST DuesNilNilNilNilNilNil Nil
Any Other DuesNilNilNilNilNilNil Nil
iiiGrand Total of all Govt Dues (as per affidavit) Nil Nil Nil Nil Nil Nil Nil
ivWhether any other liabilities are in dispute, if so, mention the amount involved and the authority before which it is pendingNilNilNilNilNilNil Nil
Totals (Calculated as Sum of Values) Rs 9,31,900
9 Lacs+
Nil
Nil
Rs 4,91,000
4 Lacs+
Rs 2,10,000
2 Lacs+
Nil
Rs 16,32,900
16 Lacs+

Disclaimer: This information is an archive of the candidate's self-declared affidavit that was filed during the elections. The current status of this information may be different. For the latest available information, please refer to the affidavit filed by the candidate to the Election Commission in the most recent election.

Data Readability Report of Liabilities :No Problems in Reading Affidavit Information

Profession or Occupation .

Self Advocate
Spouse NIL

Sources Of Income (Details)

Self Advocate
Spouse NIL
Dependent NIL

Contracts with appropriate Govt. and any public company/companies

Details of contracts entered by the candidate NA
Details of contracts entered into by spouse NA
Details of contracts entered into by dependent NA
Details of contracts entered into by Hindu undivided family or trust in which the candidate or spouse or dependents have interest NA
Details of contracts entered into by Partnership Firms in which the candidate or spouse or dependents are partners NA
Details of contracts entered into by Private Companies in which candidate or spouse or dependents have share NA



If you notice any discrepancy between affidavits and our data, you can use the message box below to send a message to us.

( यदि आप हलफनामों और इस पेज पर दी गयी जानकारी के बीच कोई विसंगति/भिन्नता पाते है तो आप नीचे के संदेश बॉक्स के उपयोग से हमें संदेश भेज सकते हैं)

Name
Email
Phone No
Enter your discrepancy
Please enter the code shown below and click Submit.



Share On:
Download App Follow us on

Disclaimer: All information on this website has been taken by ADR from the website of the Election Commission of India (https://affidavitarchive.nic.in/) and all the information is available in public domain. ADR does not add or subtract any information, unless the EC changes the data. In particular, no unverified information from any other source is used. While all efforts have been made by ADR to ensure that the information is in keeping with what is available in the ECI website, in case of discrepancy between information provided by ADR through this report, anyone and that given in the ECI website, the information available on the ECI website should be treated as correct and Association for Democratic Reforms and their volunteers are not responsible or liable for any direct, indirect special, or consequential damages, claims, demands, losses of any kind whatsoever, made, claimed, incurred or suffered by any party arising under or relating to the usage of data provided by ADR through this report. It is to be noted that ADR undertakes great care and adopts utmost due diligence in analysing and dissemination of the background information of the candidates furnished by them at the time of elections from the duly self-sworn affidavits submitted with the Election Commission of India. Such information is only aimed at highlighting the growing criminality in politics, increased misuse of money in elections so as to facilitate a system of transparency, accountability and good governance and to enable voters to form an informed choice. Therefore, it is expected that anyone using this report shall undertake due care and utmost precaution while using the data provided by ADR. ADR is not responsible for any mishandling, discrepancy, inability to understand, misinterpretation or manipulation, distortion of the data in such a way so as to benefit or target a particular political party or politician or candidate.

About MyNeta About ADR State Coordinators Contact Terms of Use FAQs